OP Labs IGF1-LR3 1mg
$46.15
🔥 Exclusive Crypto Offer
Get an INSTANT 15% DISCOUNT when you pay with Bitcoin, Ethereum, Dogecoin, Bitcoin Cash, XRP, Solana, or USDT.
âš¡ Don't have crypto? Buy it here in 5 minutes with easy guidance.
💡 Pro Tip: You can also pay with cryptocurrency using your verified Cash App or PayPal account for a fast and secure checkout!
IGF-1 LR3 is a specialised research peptide developed for advanced scientific investigation of insulin-like growth factor receptor (IGF-1R) signalling, growth factor–mediated pathways, and downstream intracellular regulatory mechanisms.
OP Labs formerly Oxford Peptides
Batch tested Purity: ≥ 99 % (HPLC, typical)
CAS Number: 946870-92-4
Molecular Formula: C400H625N111O115S9
Volume PricingSpend £150+ (20% off)£27.96Spend £500+ (30% off)£24.47Spend £1000+ (50% off)£17.48Amino Acid Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (Long-R3 IGF-1, 83 aa; 3 intramolecular disulfide bonds)
4 reviews for OP Labs IGF1-LR3 1mg
Only logged in customers who have purchased this product may leave a review.
Related products
Oxford Peptides
Oxford Peptides
Oxford Peptides
Oxford Peptides
Oxford Peptides
Oxford Peptides
Oxford Peptides
Oxford Peptides
STEVE –
Best prices, reliable and great comms
John –
Excellent product and works as I expected
Paul glad –
Made up with op labs igf1 lr3 100% 💪💪💪💪💪
Paul stewart –
This stuff is absolutely insane well worth it and good value if you buy multiple