OP Labs VIP 5mg
$36.84
🔥 Exclusive Crypto Offer
Get an INSTANT 15% DISCOUNT when you pay with Bitcoin, Ethereum, Dogecoin, Bitcoin Cash, XRP, Solana, or USDT.
âš¡ Don't have crypto? Buy it here in 5 minutes with easy guidance.
💡 Pro Tip: You can also pay with cryptocurrency using your verified Cash App or PayPal account for a fast and secure checkout!
VIP is a neuropeptide developed for experimental investigation of neuroendocrine signalling, smooth muscle regulation, and immune-modulatory pathways mediated via VPAC1 and VPAC2 receptors.
OP Labs formerly Oxford Peptides
Batch tested Purity: ≥ 99 % (HPLC, typical)
CAS Number: 40077-57-4
Peptide Type: Synthetic vasoactive intestinal peptide
Amino Acid Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 (28-mer, C-terminal amide)
Volume PricingSpend £150+ (20% off)£22.32Spend £500+ (30% off)£19.53Spend £1000+ (50% off)£13.95
2 reviews for OP Labs VIP 5mg
Only logged in customers who have purchased this product may leave a review.
Related products
Oxford Peptides
Oxford Peptides
Oxford Peptides
Oxford Peptides
Oxford Peptides
Oxford Peptides
Oxford Peptides
Oxford Peptides
Jason C. –
Had a reaction
Nick –
The aftersales service provided by Bella at OP has been superb (regarding a delivery query).
I have ordered from OP twice previously and they have always been super fast in despatch and the products of great quality and well packaged.
The products are also competitively priced – perfect for my research.