OP Labs LL37 5mg
$39.55
🔥 Exclusive Crypto Offer
Get an INSTANT 15% DISCOUNT when you pay with Bitcoin, Ethereum, Dogecoin, Bitcoin Cash, XRP, Solana, or USDT.
⚡ Don't have crypto? Buy it here in 5 minutes with easy guidance.
💡 Pro Tip: You can also pay with cryptocurrency using your verified Cash App or PayPal account for a fast and secure checkout!
LL-37 is a synthetic cathelicidin-derived antimicrobial peptide used as a research tool to investigate host-defence peptide signalling and innate immune mechanisms in experimental systems.
OP Labs formerly Oxford Peptides
Batch tested Purity: ≥ 98.5 % (HPLC, typical)
CAS Number: 154947-66-7
Molecular Formula: C205H340N60O53Amino Acid Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES (37-residue cathelicidin peptide)
Volume PricingSpend £150+ (20% off)£23.96Spend £500+ (30% off)£20.97Spend £1000+ (50% off)£14.98
Only logged in customers who have purchased this product may leave a review.
Related products
Oxford Peptides
Oxford Peptides
Oxford Peptides
Oxford Peptides
Oxford Peptides
Oxford Peptides
Oxford Peptides
Oxford Peptides
Reviews
There are no reviews yet.