OP Labs Sermorelin 2mg
$17.10
🔥 Exclusive Crypto Offer
Get an INSTANT 15% DISCOUNT when you pay with Bitcoin, Ethereum, Dogecoin, Bitcoin Cash, XRP, Solana, or USDT.
⚡ Don't have crypto? Buy it here in 5 minutes with easy guidance.
💡 Pro Tip: You can also pay with cryptocurrency using your verified Cash App or PayPal account for a fast and secure checkout!
Sermorelin is a peptide analogue of growth hormone–releasing hormone (GHRH 1–29), used in experimental research to investigate hypothalamic–pituitary signalling, growth hormone secretion dynamics, and receptor-mediated neuroendocrine regulation.
OP Labs formerly Oxford Peptides
Batch tested Purity: ≥ 99 % (HPLC, typical)
CAS Number: 86168-78-7
Peptide Type: Synthetic GHRH (1–29) analogue peptide
Amino Acid Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (GRF 1-29, C-terminal amide)
Volume PricingSpend £150+ (20% off)£10.36Spend £500+ (30% off)£9.07Spend £1000+ (50% off)£6.48
3 reviews for OP Labs Sermorelin 2mg
Only logged in customers who have purchased this product may leave a review.
Related products
Oxford Peptides
Oxford Peptides
Oxford Peptides
Oxford Peptides
Oxford Peptides
Oxford Peptides
Oxford Peptides
Oxford Peptides
Robert Patterson –
All the peptides you need at at great price
Robert Patterson –
All the best peptides available with immediate delivery
Jacqui –
Fantastic