OP Labs Tesamorelin 5mg
$36.84
🔥 Exclusive Crypto Offer
Get an INSTANT 15% DISCOUNT when you pay with Bitcoin, Ethereum, Dogecoin, Bitcoin Cash, XRP, Solana, or USDT.
⚡ Don't have crypto? Buy it here in 5 minutes with easy guidance.
💡 Pro Tip: You can also pay with cryptocurrency using your verified Cash App or PayPal account for a fast and secure checkout!
Tesamorelin is a synthetic growth hormone–releasing hormone (GHRH) analogue developed for experimental investigation of pituitary receptor–mediated signalling, growth hormone regulation, and downstream endocrine pathways.
OP Labs formerly Oxford Peptides
Batch tested Purity: ≥ 98.5 % (HPLC, typical)
CAS Number: 901758-09-6
Molecular Formula: C221H366N72O67S (net peptide); C223H370N72O69S (mono-acetate salt, as supplied)
Amino Acid Sequence: (trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 (N-terminal trans-3-hexenoyl; C-terminal amide)Molecular Weight: 5135.91 (net peptide); 5195.96 (mono-acetate salt, as supplied)
Volume PricingSpend £150+ (20% off)£22.32Spend £500+ (30% off)£19.53Spend £1000+ (50% off)£13.95
3 reviews for OP Labs Tesamorelin 5mg
Only logged in customers who have purchased this product may leave a review.
Related products
Oxford Peptides
Oxford Peptides
Oxford Peptides
Oxford Peptides
Oxford Peptides
Oxford Peptides
Oxford Peptides
Oxford Peptides
Jeff –
Good communication
Dean Jarmos –
Amazing
Michael –
Amazing stuff for hitting that stubborn fat round the stomach area